PDB entry 1tw5

View 1tw5 on RCSB PDB site
Description: beta1,4-galactosyltransferase mutant M344H-Gal-T1 in complex with Chitobiose
Class: transferase
Keywords: Met344His mutation; closed conformation; chitobiose binding, TRANSFERASE
Deposited on 2004-06-30, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Bos taurus [TaxId:9913]
    Gene: B4GALT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOPe 2.08: d1tw5a_
  • Chain 'B':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Bos taurus [TaxId:9913]
    Gene: B4GALT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOPe 2.08: d1tw5b_
  • Heterogens: MN, UDH, SO4, DIO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tw5A (A:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw5A (A:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw5B (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw5B (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps