PDB entry 1tvz

View 1tvz on RCSB PDB site
Description: Crystal structure of 3-hydroxy-3-methylglutaryl-coenzyme A synthase from Staphylococcus aureus
Class: lyase
Keywords: HMG-CoA synthase; HMGS, coenzyme A; thiolase fold; condensing enzyme; cholesterol biosynthesis, LYASE
Deposited on 2004-06-30, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxy-3-methylglutaryl-CoA synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • GB AAG02422 (Start-387)
      • modified residue (110)
      • conflict (319)
    Domains in SCOPe 2.07: d1tvza1, d1tvza2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tvzA (A:)
    mtigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvzA (A:)
    tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpe