PDB entry 1tvy

View 1tvy on RCSB PDB site
Description: beta-1,4-galactosyltransferase mutant met344his (m344h-gal-t1) complex with udp-galactose and manganese
Deposited on 2004-06-30, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tvya_
  • Chain 'B':
    Domains in SCOP 1.71: d1tvyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tvyA (A:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvyA (A:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tvyB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvyB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps