PDB entry 1tvu

View 1tvu on RCSB PDB site
Description: contributions of orientation and hydrogen bonding to catalysis in asn-229 mutants of thymidylate synthase
Class: transferase
Keywords: transferase, methyltransferase
Deposited on 1997-09-17, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: N229A MUTANT OF CLONED L. CASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (228)
    Domains in SCOPe 2.07: d1tvua_
  • Heterogens: UMP, CB3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvuA (A:)
    mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
    llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
    emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
    ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfaiasyallthlv
    ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
    llnydpypaikapvav