PDB entry 1tvt

View 1tvt on RCSB PDB site
Description: structure of the equine infectious anemia virus tat protein
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1994-07-07, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transactivator protein
    Species: Equine infectious anemia virus [TaxId:11665]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tvta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvtA (A:)
    ledrripgtaeenlqkssggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkq
    rlkaiqqgrqpqyll