PDB entry 1tvq

View 1tvq on RCSB PDB site
Description: Crystal Structure of Apo Chicken Liver Basic Fatty Acid Binding Protein (or Bile Acid Binding Protein)
Class: lipid binding protein
Keywords: Lb-FABP, FABP, BABP, INTRACELLULAR BILE ACID-BINDING PROTEIN, LIPID BINDING PROTEIN
Deposited on 2004-06-30, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvqA (A:)
    afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
    sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
    rskrv