PDB entry 1tvp

View 1tvp on RCSB PDB site
Description: Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose
Class: hydrolase
Keywords: Glycoside hydrolase, Clan GH-A, family 5-2, cellulase, Cellobiose complex
Deposited on 2004-06-30, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.158
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: celG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvpa_
  • Chain 'B':
    Compound: cellulase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: celG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvpb_
  • Heterogens: CBI, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvpA (A:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgwgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tvpB (B:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgwgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvpB (B:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgw