PDB entry 1tvo

View 1tvo on RCSB PDB site
Description: The structure of ERK2 in complex with a small molecule inhibitor
Class: transferase
Keywords: kinase, protein-inhibitor complex, transferase
Deposited on 2004-06-30, released 2005-09-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.265
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tvoa_
  • Heterogens: FRZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tvoA (A:)
    maaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfe
    hqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqh
    lsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdh
    tgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhi
    lgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphk
    rieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    gdlgsdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvoA (A:)
    gagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
    lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg