PDB entry 1tvn

View 1tvn on RCSB PDB site
Description: Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme
Class: hydrolase
Keywords: Glycoside hydrolase, Clan GH-A, Family 5-2, Cellulase
Deposited on 2004-06-30, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.15
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: celG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvna1
  • Chain 'B':
    Compound: cellulase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: celG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvnA (A:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgwgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tvnB (B:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgwgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvnB (B:)
    avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
    ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
    kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
    qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
    awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgw