PDB entry 1tvm

View 1tvm on RCSB PDB site
Description: NMR structure of enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system
Deposited on 2004-06-29, released 2005-09-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, galactitol-specific IIB component
    Species: Escherichia coli [TaxId:562]
    Gene: GATB, C2618, Z3256, ECS2896, SF2155, S2281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X7H5 (20-112)
      • expression tag (0-19)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1tvmA (A:)
    mgsshhhhhhhhenlyfqgskrkiivacggavatstmaaeeikelcqshnipveliqcrv
    neietymdgvhlicttarvdrsfgdiplvhgmpfvsgvgiealqnkiltilqg