PDB entry 1tvk

View 1tvk on RCSB PDB site
Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography
Deposited on 2004-06-29, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: EDIF
Resolution: 2.89 Å
R-factor: 0.333
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tvkA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvkA (A:)
    recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
    hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
    gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
    aiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqtnlvpyprghf
    platyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccllyrgdvvpkd
    vnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcmlsnttaiaea
    warldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tvkB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tvkB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqd