PDB entry 1tvg

View 1tvg on RCSB PDB site
Description: X-ray structure of human PP25 gene product, HSPC034. Northeast Structural Genomics Target HR1958.
Class: cell cycle
Keywords: CELL CYCLE, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-06-29, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.215
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LOC51668 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tvga_
  • Heterogens: CA, SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tvgA (A:)
mghhhhhhshmrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefi
icfhkhvrierlviqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgs
atylrfiivsafdhfasvhsvsaegtvvsnlss

    Sequence, based on observed residues (ATOM records): (download) 
    >1tvgA (A:)
idlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlv
iqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivsafd
hfasvhsvsaegtvvs