PDB entry 1tvf

View 1tvf on RCSB PDB site
Description: Crystal Structure of penicillin-binding protein 4 (PBP4) from Staphylococcus aureus
Class: penicillin binding
Keywords: Structural Genomics, NYSGXRC TARGET, T72, PBP4, SAV0642, SA0598, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, PENICILLIN BINDING
Deposited on 2004-06-29, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 4
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: PBP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53613 (6-368)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d1tvfa1, d1tvfa2, d1tvfa3
  • Chain 'B':
    Compound: penicillin binding protein 4
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: PBP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53613 (6-368)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d1tvfb1, d1tvfb2, d1tvfb3
  • Heterogens: SO4, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvfA (A:)
    gphtssyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpa
    smtklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqi
    tvsnssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptk
    ykdqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpg
    tdglktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdq
    ykyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdy
    gpptvevhq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvfB (B:)
    gphtssyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpa
    smtklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqi
    tvsnssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptk
    ykdqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpg
    tdglktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdq
    ykyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdy
    gpptvevhq