PDB entry 1tvd

View 1tvd on RCSB PDB site
Description: variable domain of t cell receptor delta chain
Class: immunoreceptor
Keywords: immunoreceptor, tcr, delta chain, variable domain
Deposited on 1997-10-19, released 1998-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S04934 (0-115)
      • conflict (51)
      • conflict (97-98)
    Domains in SCOPe 2.04: d1tvda_
  • Chain 'B':
    Compound: t cell receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S04934 (0-115)
      • conflict (51)
      • conflict (97-98)
    Domains in SCOPe 2.04: d1tvdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvdA (A:)
    dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
    tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvdB (B:)
    dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
    tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep