PDB entry 1tvc

View 1tvc on RCSB PDB site
Description: FAD and NADH binding domain of methane monooxygenase reductase from Methylococcus capsulatus (Bath)
Class: oxidoreductase
Keywords: fad-binding; nadh-binding, oxidoreductase
Deposited on 2004-06-29, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methane monooxygenase component c
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: mmoC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvca1, d1tvca2
  • Heterogens: FDA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tvcA (A:)
    crisfgevgsfeaevvglnwvssntvqfllqkrpdecgnrgvkfepgqfmdltipgtdvs
    rsyspanlpnpegrleflirvlpegrfsdylrndarvgqvlsvkgplgvfglkergmapr
    yfvaggtglapvvsmvrqmqewtapnetriyfgvntepelfyidelkslersmrnltvka
    cvwhpsgdwegeqgspidalredlessdanpdiylcgppgmidaacelvrsrgipgeqvf
    fekflpsgaa