PDB entry 1tv8

View 1tv8 on RCSB PDB site
Description: Structure of MoaA in complex with S-adenosylmethionine
Deposited on 2004-06-28, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tv8a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tv8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tv8A (A:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv8A (A:)
    eqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvy
    aelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrr
    invsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmle
    yfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyr
    hkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelk
    eqfkalwqirddrysdertaqtvanrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tv8B (B:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv8B (B:)
    qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
    elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
    nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
    fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
    kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
    qfkalwqirddrysdertaqtvanrq