PDB entry 1tv7

View 1tv7 on RCSB PDB site
Description: Structure of the S-adenosylmethionine dependent Enzyme MoaA
Class: ligand binding protein
Keywords: TIM barrel, LIGAND BINDING PROTEIN
Deposited on 2004-06-28, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tv7a_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tv7b_
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tv7A (A:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv7A (A:)
    eqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvy
    aelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrr
    invsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmle
    yfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyr
    hkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelk
    eqfkalwqirddrysdertaqtvanrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tv7B (B:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv7B (B:)
    qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
    elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
    nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
    fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
    kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
    qfkalwqirddrysdertaqtvanrq