PDB entry 1tv5

View 1tv5 on RCSB PDB site
Description: Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor
Class: oxidoreductase
Keywords: alpha-beta barrel; tim barrel, OXIDOREDUCTASE
Deposited on 2004-06-27, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase homolog, mitochondrial
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: dhod
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tv5a1
  • Heterogens: SO4, A26, FMN, ORO, N8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tv5A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkfesynpefflydiflkfclkyidgeichd
    lflllgkynilpydtsndsiyactnikhldfinpfgvaagfdkngvcidsilklgfsfie
    igtitprgqtgnakprifrdvesrsiinscgfnnmgcdkvtenlilfrkrqeedkllskh
    ivgvsigknkdtvnivddlkycinkigryadyiainvsspntpglrdnqeagklkniils
    vkeeidnleknnimndestynednkivekknnfnknnshmmkdakdnflwfnttkkkplv
    fvklapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdist
    kficemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrel
    nhllyqrgyynlkeaigrkhsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv5A (A:)
    fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
    inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
    fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
    yiainvsspntpglrdnqeagklkniilsvkeeidnleflwfnttkkkplvfvklapdln
    qeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemyny
    tnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgy
    ynlkeaigrkh