PDB entry 1tv3

View 1tv3 on RCSB PDB site
Description: Crystal structure of the N-methyl-hydroxylamine MtmB complex
Class: transferase
Keywords: Tim barrel, TRANSFERASE
Deposited on 2004-06-26, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.146
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monomethylamine methyltransferase mtmB1
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tv3a_
  • Heterogens: BG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tv3A (A:)
    mtfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmme
    klfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgd
    kakpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaa
    ktetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidl
    daisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvh
    irwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasg
    reilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasap
    agktfqecydvktvtpteeymqvydgarkkledlglvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tv3A (A:)
    tfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmmek
    lfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgdk
    akpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaak
    tetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidld
    aisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvhi
    rwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasgr
    eilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasapa
    gktfqecydvktvtpteeymqvydgarkkledlglvf