PDB entry 1tv0

View 1tv0 on RCSB PDB site
Description: Solution structure of cryptdin-4, the most potent alpha-defensin from mouse Paneth cells
Class: antimicrobial protein
Keywords: beta sheet, beta hairpin, ANTIMICROBIAL PROTEIN
Deposited on 2004-06-25, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cryptdin-4
  Species: Mus musculus [TaxId:10090]
  Gene: Defcr4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28311 (0-31)
  Domains in SCOPe 2.08: d1tv0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tv0A (A:)
  gllcycrkghckrgervrgtcgirflyccprr