PDB entry 1tuz

View 1tuz on RCSB PDB site
Description: NMR Structure of the Diacylglycerol kinase alpha, NESGC target HR532
Class: transferase
Keywords: Kinase, Transferase, HR532, NESGC, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2004-06-25, released 2005-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: diacylglycerol kinase alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: DAGK1
  Database cross-references and differences (RAF-indexed):
  • GB AAC34806 (0-117)
  Domains in SCOPe 2.06: d1tuza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tuzA (A:)
  makerglispsdfaqlqkymeystkkvsdvlklfedgemakyvqgdaigyegfqqflkiy
  levdnvprhlslalfqsfetghclnetnvtkdvvclndvscyfslleggrpedklews