PDB entry 1tux

View 1tux on RCSB PDB site
Description: high resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus
Class: hydrolase
Keywords: xylan degradation, hydrolase, glycosidase, enzyme, 1,4-beta-xylan xylanohydrolase
Deposited on 1998-10-29, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Thermoascus aurantiacus [TaxId:5087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23360 (1-300)
      • conflict (10)
      • conflict (95)
      • conflict (114)
      • conflict (119)
      • conflict (144)
      • conflict (157)
      • conflict (180)
      • conflict (184)
      • conflict (188)
      • conflict (192)
      • conflict (217-219)
      • conflict (223)
      • conflict (239)
      • conflict (243)
      • conflict (249)
      • conflict (256)
      • conflict (258)
      • conflict (261)
      • conflict (299)
    Domains in SCOPe 2.07: d1tuxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuxA (A:)
    aaaqsvdqlidargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
    fnfagadylvnwaqqngklirghtlvwhsqlpswvvsitdkntltnvmknhittimtryi
    gkirawdvvneafnedgslrqtvfnnvigedyipiafrtaraadpnaklyindynldsas
    kpktsaivkrvkkwraagvpidgigsqthlsagqgasidaalpnlasagtpevaiteldi
    agatstdyvdvvnacldvdscigitvwgvadpdswrasttpllfdgnfnpkpaynaivql
    l