PDB entry 1tuw

View 1tuw on RCSB PDB site
Description: structural and functional analysis of tetracenomycin f2 cyclase from streptomyces glaucescens: a type-ii polyketide cyclase
Deposited on 2004-06-25, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tuwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuwA (A:)
    mayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddim
    erlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtapds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuwA (A:)
    ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime
    rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap