PDB entry 1tuw

View 1tuw on RCSB PDB site
Description: Structural and Functional Analysis of Tetracenomycin F2 Cyclase from Streptomyces glaucescens: A Type-II Polyketide Cyclase
Class: unknown function
Keywords: dimeric ??? ferredoxin-like fold tetracenomycin C biosynthesis, UNKNOWN FUNCTION
Deposited on 2004-06-25, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetracenomycin polyketide synthesis protein tcmI
    Species: Streptomyces glaucescens [TaxId:1907]
    Gene: TCMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tuwa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuwA (A:)
    mayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddim
    erlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtapds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuwA (A:)
    ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime
    rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap