PDB entry 1tuv

View 1tuv on RCSB PDB site
Description: Crystal structure of YgiN in complex with menadione
Deposited on 2004-06-25, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tuva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuvA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpgisgrvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuvA (A:)
    mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
    vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg