PDB entry 1tuu

View 1tuu on RCSB PDB site
Description: Acetate Kinase crystallized with ATPgS
Class: transferase
Keywords: alpha/beta, ASKHA (acetate and sugar kinases, HSC70 Actin) superfamily, two similar domains, TRANSFERASE
Deposited on 2004-06-25, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetate kinase
    Species: Methanosarcina thermophila [TaxId:2210]
    Gene: ACKA, ACK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuua1, d1tuua2
  • Chain 'B':
    Compound: acetate kinase
    Species: Methanosarcina thermophila [TaxId:2210]
    Gene: ACKA, ACK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuub1, d1tuub2
  • Heterogens: SO4, ADP, NH4, AMP, PIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuuA (A:)
    mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
    kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
    plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
    gtshkyvaeraalmlgkpaeetkiitchlgngssitaveggksvetsmgftpleglamgt
    rcgsidpaivpflmekeglttreidtlmnkksgvlgvsglsndfrdldeaaskgnrkael
    aleifaykvkkfigeysavlngadavvftagigensasirkriltgldgigikiddeknk
    irgqeidistpdakvrvfviptneelaiaretkeivete
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tuuB (B:)
    mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
    kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
    plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
    gtshkyvaeraalmlgkpaeetkiitchlgngssitaveggksvetsmgftpleglamgt
    rcgsidpaivpflmekeglttreidtlmnkksgvlgvsglsndfrdldeaaskgnrkael
    aleifaykvkkfigeysavlngadavvftagigensasirkriltgldgigikiddeknk
    irgqeidistpdakvrvfviptneelaiaretkeivete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuuB (B:)
    mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
    kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
    plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
    gtshkyvaeraalmlgkpaeetkiitchlgngssitaveggksvetsmgftpleglamgt
    rcgsidpaivpflmekeglttreidtlmnkksgvlgvsglsndfrdldeaaskgnrkael
    aleifaykvkkfigeysavlngadavvftagigensasirkriltgldgigikiddeknk
    irgqeidistpdakvrvfviptneelaiaretkeivet