PDB entry 1tum

View 1tum on RCSB PDB site
Description: mutt pyrophosphohydrolase-metal-nucleotide-metal complex, nmr, 16 structures
Class: mutator protein
Keywords: mutator protein, quaternary complex, nucleoside triphosphate pyrophosphohydrolase, mutt pyrophosphohydrolase-metal-substrate analog complex
Deposited on 1996-12-05, released 1997-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 1997-05-15, with a file datestamp of 2007-06-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mutator mutT protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tuma_
  • Heterogens: MG, APC, CON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tumA (A:)
    mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
    tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
    pviaklkrl