PDB entry 1tuh

View 1tuh on RCSB PDB site
Description: Structure of Bal32a from a Soil-Derived Mobile Gene Cassette
Class: unknown function
Keywords: uncultured, UNKNOWN FUNCTION
Deposited on 2004-06-25, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein EGC068
    Species: Uncultured bacterium [TaxId:77133]
    Gene: EGC068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuha_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuhA (A:)
    mhhhhhhmgivtgpiidhskendvmneaeqnaetvrrgyaafnsgdmktltelfdenasw
    htpgrsriagdhkgreaifaqfgryggetggtfkavllhvlksddgrvigihrntaergg
    krldvgccivfefkngrvidgrehfydlyawdefwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuhA (A:)
    neaeqnaetvrrgyaafnsgdmktltelfdenaswhtpgrsriagdhkgreaifaqfgry
    ggetggtfkavllhvlksddgrvigihrntaerggkrldvgccivfefkngrvidgrehf
    ydlyawdefwr