PDB entry 1tue

View 1tue on RCSB PDB site
Description: The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2
Class: replication
Keywords: Human papillomavirus, helicase, replication, E1E2 complex, AAA+ protein
Deposited on 2004-06-24, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06789 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d1tuea1, d1tuea2
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80B71 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d1tueb1, d1tueb2
  • Chain 'D':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tued_
  • Chain 'E':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuee_
  • Chain 'F':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuef_
  • Chain 'G':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tueg_
  • Chain 'H':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tueh_
  • Chain 'J':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuej_
  • Chain 'K':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuek_
  • Chain 'L':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuel_
  • Chain 'M':
    Compound: replication protein e1
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tuem_
  • Chain 'Q':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 18 [TaxId:333761]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tueq_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tueA (A:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueA (A:)
    sgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcg
    pantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymr
    naldgnpisidpliqlkcppillttnihpakdnrwpylesritvfefpnafpfdkngnpv
    yeindknwkcffertwsrldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tueB (B:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueB (B:)
    hmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtln
    hqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggq
    tvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkse
    cekygntgtwevhf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tueD (D:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueD (D:)
    nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
    tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
    dgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnafpfdkngnp
    vyeindknwkcffertwsrldl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tueE (E:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueE (E:)
    tpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqv
    vpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvq
    vyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefksecek
    ygntgtwevhfgnnvi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tueF (F:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueF (F:)
    nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
    tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
    dgnpkcppillttnihpakdnrwpylesritvfefpnafpfdkngnpvyeindknwkcff
    ertwsrld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tueG (G:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueG (G:)
    pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
    payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
    yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
    gntgtwevhfgnnvid
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tueH (H:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueH (H:)
    nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
    tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
    dgnpisikcppillttnihpakdnrwpylesritvfefpnafpfdkngnpvyeindknwk
    cffertwsrld
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tueJ (J:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueJ (J:)
    pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
    payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
    yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
    gntgtwevhfgnnv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tueK (K:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueK (K:)
    nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
    tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
    dgnpiqlkcppillttnihpakdnrwpylesritvfefpnafpfdkngnpvyeindknwk
    cffertwsrldl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tueL (L:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueL (L:)
    pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
    payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
    yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
    gtgtwevhfgnnv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1tueM (M:)
    gsefgsgsnmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknc
    lvfcgpantgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyf
    dtymrnaldgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnaf
    pfdkngnpvyeindknwkcffertwsrldlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueM (M:)
    nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
    tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
    dgnpisidliqlkcppillttnihpakdrwpylesritvfefpnafpfdkngnpvyeind
    knwkcffertwsrldl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1tueQ (Q:)
    gshmqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqt
    lnhqvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkg
    gqtvqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefk
    secekygntgtwevhfgnnvidcndsmcstsddtvsat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tueQ (Q:)
    pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
    payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
    yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
    gntgtwevhfgnnv