PDB entry 1tub

View 1tub on RCSB PDB site
Description: tubulin alpha-beta dimer, electron diffraction
Class: microtubules
Keywords: microtubules, alpha-tubulin, beta-tubulin, gtpase
Deposited on 1997-09-23, released 1998-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02550 (0-439)
      • conflict (264)
    Domains in SCOPe 2.05: d1tuba1, d1tuba2
  • Chain 'B':
    Compound: tubulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tubb1, d1tubb2
  • Heterogens: GTP, GDP, TXL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tubA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tubB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqd