PDB entry 1tua

View 1tua on RCSB PDB site
Description: 1.5 A Crystal Structure of a Protein of Unknown Function APE0754 from Aeropyrum pernix
Class: structural genomics, unknown function
Keywords: Structural Genomics, protein structure initiative, MCSG, Aeropyrum pernix, Four layers alpha-beta sandwich, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-06-24, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein APE0754
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: GI:14600942
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YE16 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1tuaa1, d1tuaa2, d1tuaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuaA (A:)
    amkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnl
    mkaaevvkaislgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrar
    rtieemtdtyinvgeyevaiigdyeramaakqaiemlaegrmhstvyrhlerimreikrr
    erlkmwareel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuaA (A:)
    amkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnl
    mkaaevvkaislgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrar
    rtieemtdtyinvgeyevaiigdyeramaakqaiemlaegrmhstvyrhlerimreikrr
    erlkmware