PDB entry 1tua

View 1tua on RCSB PDB site
Description: 1.5 A Crystal Structure of a Protein of Unknown Function APE0754 from Aeropyrum pernix
Deposited on 2004-06-24, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuaA (A:)
    amkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnl
    mkaaevvkaislgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrar
    rtieemtdtyinvgeyevaiigdyeramaakqaiemlaegrmhstvyrhlerimreikrr
    erlkmwareel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuaA (A:)
    amkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnl
    mkaaevvkaislgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrar
    rtieemtdtyinvgeyevaiigdyeramaakqaiemlaegrmhstvyrhlerimreikrr
    erlkmware