PDB entry 1tu9

View 1tu9 on RCSB PDB site
Description: Crystal Structure of a Protein PA3967, a Structurally Highly Homologous to a Human Hemoglobin, from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: Structural genomics, Heme, hemoglobin, Pseudomonas aeruginosa PAO1, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-06-24, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.164
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA3967
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX49 (Start-131)
      • cloning artifact (132-133)
    Domains in SCOPe 2.08: d1tu9a1, d1tu9a2
  • Heterogens: HEM, PPI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tu9A (A:)
    ghmnaadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnl
    vmyargmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdv
    mgrgiaviksyygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu9A (A:)
    naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy
    argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr
    giaviksyygs