PDB entry 1tu7

View 1tu7 on RCSB PDB site
Description: Structure of Onchocerca Volvulus Pi-class Glutathione S-transferase
Class: transferase
Keywords: transferase
Deposited on 2004-06-24, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase 2
    Species: Onchocerca volvulus [TaxId:6282]
    Gene: GST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46427 (0-207)
      • see remark 999 (176)
    Domains in SCOPe 2.08: d1tu7a1, d1tu7a2
  • Chain 'B':
    Compound: Glutathione S-transferase 2
    Species: Onchocerca volvulus [TaxId:6282]
    Gene: GST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46427 (0-207)
      • see remark 999 (176)
    Domains in SCOPe 2.08: d1tu7b1, d1tu7b2
  • Heterogens: GSH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tu7A (A:)
    msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
    vqsgailrhlarkynlngenemettyidmfcegvrdlhvkytrmiymayetekdpyiksi
    lpgelakfekllatrgngrnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhq
    rmkdrpklkeycekrdaakvpvngngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tu7B (B:)
    msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
    vqsgailrhlarkynlngenemettyidmfcegvrdlhvkytrmiymayetekdpyiksi
    lpgelakfekllatrgngrnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhq
    rmkdrpklkeycekrdaakvpvngngkq