PDB entry 1tu4

View 1tu4 on RCSB PDB site
Description: Crystal Structure of Rab5-GDP Complex
Deposited on 2004-06-24, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tu4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1tu4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1tu4c_
  • Chain 'D':
    Domains in SCOP 1.71: d1tu4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tu4A (A:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4A (A:)
    gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
    dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
    adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tu4B (B:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4B (B:)
    icqfklvllgesavgksslvlrfvkgqfqestigaafltqtvclddttvkfeiwdtagqe
    ryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadlank
    ravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tu4C (C:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4C (C:)
    gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
    dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
    adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tu4D (D:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4D (D:)
    nkicqfklvllgesavgksslvlrfvkgqfhestigaafltqtvclddttvkfeiwdtag
    qeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadla
    nkravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp