PDB entry 1tu4

View 1tu4 on RCSB PDB site
Description: Crystal Structure of Rab5-GDP Complex
Class: protein transport
Keywords: rab5, gtpase, protein transport
Deposited on 2004-06-24, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-5A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5A, RAB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20339 (1-End)
      • modified residue (74)
      • modified residue (146)
      • modified residue (154)
      • modified residue (161)
    Domains in SCOPe 2.07: d1tu4a_
  • Chain 'B':
    Compound: Ras-related protein Rab-5A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5A, RAB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20339
      • modified residue (74)
      • modified residue (146)
      • modified residue (154)
      • modified residue (161)
    Domains in SCOPe 2.07: d1tu4b_
  • Chain 'C':
    Compound: Ras-related protein Rab-5A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5A, RAB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20339 (1-End)
      • modified residue (74)
      • modified residue (146)
      • modified residue (154)
      • modified residue (161)
    Domains in SCOPe 2.07: d1tu4c_
  • Chain 'D':
    Compound: Ras-related protein Rab-5A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5A, RAB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20339
      • modified residue (74)
      • modified residue (146)
      • modified residue (154)
      • modified residue (161)
    Domains in SCOPe 2.07: d1tu4d_
  • Heterogens: CO, SO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tu4A (A:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4A (A:)
    gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
    dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
    adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tu4B (B:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4B (B:)
    icqfklvllgesavgksslvlrfvkgqfqestigaafltqtvclddttvkfeiwdtagqe
    ryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadlank
    ravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tu4C (C:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4C (C:)
    gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
    dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
    adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tu4D (D:)
    mgnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfei
    wdtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgn
    kadlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu4D (D:)
    nkicqfklvllgesavgksslvlrfvkgqfhestigaafltqtvclddttvkfeiwdtag
    qeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadla
    nkravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp