PDB entry 1tu2

View 1tu2 on RCSB PDB site
Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Class: electron transport
Keywords: electron transport, paramagnetic, chemical shift, complex formation, dynamic complex, photosynthesis, pseudocontact shift, electron transport proteins complex
Deposited on 2004-06-24, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: NOSTOC SP. [TaxId:1168]
    Gene: PETE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tu2a1
  • Chain 'B':
    Compound: Apocytochrome f
    Species: NOSTOC SP. [TaxId:1168]
    Gene: PETA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tu2b1, d1tu2b2
  • Heterogens: CU, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tu2A (A:)
    etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
    hkqllmspgqststtfpadapageytfycephrgagmvgkitvag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tu2B (B:)
    ypfwaqqtypetpreptgrivcanchlaakptevevpqsvlpdtvfkavvkipydtsvqq
    vgadgskvglnvgavlmlpegfkiapedripeelkeeigdvyfqpygedkdnivivgplp
    geqyqeivfpvlspnpandknihfgkysvhvggnrgrgqvyptgeksnnnlysaaatgti
    skiakqegedgsvkylvdiktesgevvsdtipagpelivsegqavtagdaltnnpnvggf
    gqldaeivlqdanr