PDB entry 1tu1

View 1tu1 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function PA94 from Pseudomonas aeruginosa, Putative Regulator
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PA0094, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-06-24, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA0094
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA0094
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I738 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1tu1a1, d1tu1a2
  • Chain 'B':
    Compound: hypothetical protein PA0094
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA0094
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I738 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1tu1b1, d1tu1b2
  • Heterogens: SO4, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tu1A (A:)
    ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
    lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
    tpadlphhepawkqamqtlvprptpsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu1A (A:)
    ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
    lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
    tpadlphhepawkqamqtlvprpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tu1B (B:)
    ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
    lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
    tpadlphhepawkqamqtlvprptpsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu1B (B:)
    ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
    lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
    tpadlphhepawkqamqtlvprpt