PDB entry 1ttz

View 1ttz on RCSB PDB site
Description: X-ray structure of Northeast Structural Genomics target protein XcR50 from X. campestris
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-06-23, released 2004-07-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: Xanthomonas campestris
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8P6W3
    • modified residue (54)
  Domains in SCOP 1.73: d1ttza_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ttzA (A:)
  maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
  wpfdaprlrawldaaphalehhhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ttzA (A:)
  altlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldw
  pfdaprlrawldaap