PDB entry 1ttz

View 1ttz on RCSB PDB site
Description: x-ray structure of northeast structural genomics target protein xcr50 from x. campestris
Deposited on 2004-06-23, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ttza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ttzA (A:)
maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
wpfdaprlrawldaaphalehhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1ttzA (A:)
altlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldw
pfdaprlrawldaap