PDB entry 1tty

View 1tty on RCSB PDB site
Description: Solution structure of sigma A region 4 from Thermotoga maritima
Class: transcription
Keywords: sigma factor, rna polymerase, helix-turn-helix, TRANSCRIPTION
Deposited on 2004-06-23, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RPOD, SIGA, TM1451
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ttya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ttyA (A:)
    keamrmlmreelekvlktlspreamvlrmryglldgkpktleevgqyfnvtrerirqiev
    kalrklrhpsrskylksllslmdeneg