PDB entry 1ttx

View 1ttx on RCSB PDB site
Description: Solution Stucture of human beta parvalbumin (oncomodulin) refined with a paramagnetism based strategy
Class: metal binding protein
Keywords: calcium, oncomodulin, EF-hand, NMR, lanthanide, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN
Deposited on 2004-06-23, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oncomodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32930 (0-108)
      • engineered (19)
    Domains in SCOPe 2.06: d1ttxa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ttxA (A:)
    msitdvlsaddiaaalqecrdpdtfepqkffqtsglskmsanqvkdvfrfidndqsgyld
    eeelkfflqkfesgareltesetkslmaaadndgdgkigaeefqemvhs