PDB entry 1ttw

View 1ttw on RCSB PDB site
Description: Crystal structure of the Yersinia Pestis type III secretion chaperone SycH in complex with a stable fragment of YscM2
Class: chaperone
Keywords: Chaperone, type III secretion
Deposited on 2004-06-23, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secretion chaperone
    Species: Yersinia pestis [TaxId:214092]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ttwa_
  • Chain 'B':
    Compound: YscM2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_783723
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ttwA (A:)
mrtysslleefatelgleeietnelghgavtidkiwvvhlapinekelvafmragiltgq
sqlydilrknlfsplsgvircaldkddhwllwsqlnindtsgtqlasvltslvdkavtls
ceptmkkeeddhrpsssh

    Sequence, based on observed residues (ATOM records): (download) 
    >1ttwA (A:)
tysslleefatelgleeietnelghgavtidkiwvvhlapinekelvafmragiltgqsq
lydilrknlfsplsgvircaldkddhwllwsqlnindtsgtqlasvltslvdkavtls

  • Chain 'B':
    No sequence available.