PDB entry 1ttv

View 1ttv on RCSB PDB site
Description: NMR Structure of a Complex Between MDM2 and a Small Molecule Inhibitor
Class: ligase
Keywords: MDM2, protein-protein interaction, LIGASE
Deposited on 2004-06-23, released 2005-01-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-protein ligase e3 mdm2
  Species: Xenopus laevis [TaxId:8355]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56273 (0-106)
    • engineered (37)
    • engineered (79)
    • engineered (82)
  Domains in SCOPe 2.01: d1ttva_
• Heterogens: IMY

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ttvA (A:)
  nhistsdqeklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivh
  csndplgelfgvqefsvkehrriyamisrnlvsanvkessedifgnv