PDB entry 1ttv

View 1ttv on RCSB PDB site
Description: NMR Structure of a Complex Between MDM2 and a Small Molecule Inhibitor
Class: ligase
Keywords: MDM2, protein-protein interaction
Deposited on 2004-06-23, released 2005-01-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-04, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Xenopus laevis
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (0-106)
      • engineered (37)
      • engineered (79)
      • engineered (82)
    Domains in SCOP 1.73: d1ttva_
  • Heterogens: IMY

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ttvA (A:)
    nhistsdqeklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivh
    csndplgelfgvqefsvkehrriyamisrnlvsanvkessedifgnv