PDB entry 1ttu

View 1ttu on RCSB PDB site
Description: Crystal Structure of CSL bound to DNA
Class: transcription
Keywords: beta-trefoil domain, protein-DNA complex, rel homology region, CSL, Notch signaling, transcription factor
Deposited on 2004-06-23, released 2004-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.201
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lin-12 And Glp-1 transcriptional regulator
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LAG-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ttua1, d1ttua2, d1ttua3
  • Chain 'B':
    Compound: 5'-d(*tp*tp*ap*cp*tp*gp*tp*gp*gp*gp*ap*ap*ap*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*ap*ap*tp*cp*tp*tp*tp*cp*cp*cp*ap*cp*ap*gp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ttuA (A:)
    gplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciylig
    qgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfst
    gkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikvi
    skpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaft
    ihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascs
    eepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkaey
    rffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrse
    eslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ttuA (A:)
    vqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkd
    rvaqlykteqqatelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlna
    qffygcgmeiggfvsqrikviskpskkkqsmkntdckylciasgtkvalfnrlrsqtvst
    rylhvegnafhasstkwgaftihlfdderglqetdnfavrdgfvyygsvvklvdsvtgia
    lprlrirkvdkqqvildascseepvsqlhkcafqmidnelvylclshdkiiqhqataine
    hrhqindgaawtiistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrd
    fkpnlkvwfgatpvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrd
    dgvvyssgltfsyks
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.