PDB entry 1ttu

View 1ttu on RCSB PDB site
Description: Crystal Structure of CSL bound to DNA
Deposited on 2004-06-23, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.201
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ttuA (A:)
    gplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciylig
    qgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfst
    gkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikvi
    skpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaft
    ihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascs
    eepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkaey
    rffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrse
    eslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ttuA (A:)
    vqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkd
    rvaqlykteqqatelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlna
    qffygcgmeiggfvsqrikviskpskkkqsmkntdckylciasgtkvalfnrlrsqtvst
    rylhvegnafhasstkwgaftihlfdderglqetdnfavrdgfvyygsvvklvdsvtgia
    lprlrirkvdkqqvildascseepvsqlhkcafqmidnelvylclshdkiiqhqataine
    hrhqindgaawtiistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrd
    fkpnlkvwfgatpvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrd
    dgvvyssgltfsyks