PDB entry 1ttr

View 1ttr on RCSB PDB site
Description: transthyretin-v/122/I cardiomyopathic mutant
Class: transport (thyroxine)
Keywords: albumin, transport (thyroxine), retinol-binding, vitamin a
Deposited on 1996-04-11, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (121)
    Domains in SCOPe 2.07: d1ttra_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (121)
    Domains in SCOPe 2.07: d1ttrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ttrA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vitnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ttrA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavitnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ttrB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vitnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ttrB (B:)
    skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavitn