PDB entry 1ttn

View 1ttn on RCSB PDB site
Description: Solution structure of the ubiquitin-like domain of human DC-UBP from dendritic cells
Class: signaling protein
Keywords: Ubiquitin-like Domain, DC-UBP, Solution Structure, NMR, SIGNALING PROTEIN
Deposited on 2004-06-23, released 2005-07-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dendritic cell-derived ubiquitin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ttna1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ttnA (A:)
mieeksdietldipepppnsgyecqlrlrlstgkdlklvvrstdtvfhmkrrlhaaegve
pgsqrwffsgrpltdkmkfeelkipkdyvvqvivsqpvqnptpven

    Sequence, based on observed residues (ATOM records): (download) 
    >1ttnA (A:)
gyecqlrlrlstgkdlklvvrstdtvfhmkrrlhaaegvepgsqrwffsgrpltdkmkfe
elkipkdyvvqvivsqpvqn