PDB entry 1tti

View 1tti on RCSB PDB site
Description: three new crystal structures of point mutation variants of monotim: conformational flexibility of loop-1,loop-4 and loop-8
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1995-04-19, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.178
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • engineered (67-70)
      • engineered (73)
      • conflict (74)
      • engineered (92)
    Domains in SCOPe 2.07: d1ttia_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ttiA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadglaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ttiA (A:)
    skpqpiaaanwkslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqna
    gnadglaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqer
    esgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalirswv
    sskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikatq